PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10008859m
Common NameCARUB_v10008859mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 522aa    MW: 56591.3 Da    PI: 8.7691
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10008859mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1079.6e-34236292259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      dDgynWrKYGqK+vkgsefprsYY+Ct +gCpvkkkvers  d++v+ei+Y+g+H he
  Carubv10008859m 236 DDGYNWRKYGQKQVKGSEFPRSYYKCTNPGCPVKKKVERSL-DGQVTEIIYKGQHSHE 292
                      8****************************************.***************8 PP

2WRKY104.55.7e-33415473159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+a+d k+v++tYeg+Hnh+
  Carubv10008859m 415 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDAKAVVTTYEGKHNHD 473
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-29229294IPR003657WRKY domain
SuperFamilySSF1182907.72E-26233294IPR003657WRKY domain
SMARTSM007745.0E-38235293IPR003657WRKY domain
PROSITE profilePS5081124.283236294IPR003657WRKY domain
PfamPF031066.2E-26236291IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.7E-36400475IPR003657WRKY domain
SuperFamilySSF1182905.23E-29407475IPR003657WRKY domain
PROSITE profilePS5081137.619410475IPR003657WRKY domain
SMARTSM007742.0E-38415474IPR003657WRKY domain
PfamPF031062.4E-25416473IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MSEKEEAPST SKSTGAPSRP TLSLPPRPFT EMFFNGGVGF SPGPMTLVSN MFSDSDEFRS  60
FSQLLAGAMA SPATAAAAAS TATDYQRIAE GNNNNHSSSS GGVDVDPRFK QSRPTGLMIS  120
QSQSPSIFTV PPGLSPAMRL DSPSFLGLFS PVQGSYGMTH QQALAQVTAQ AVQANANMQP  180
QTEYPPSSQV QSFSSAQAQI LTSAPHSSVP AQRETSDVTI IEHRSQQPVN VDKPADDGYN  240
WRKYGQKQVK GSEFPRSYYK CTNPGCPVKK KVERSLDGQV TEIIYKGQHS HEPPQNTKRG  300
NKDSSANLNG SLINNNRGSS ELAASQFQTN SSNKTKREQH EAASQATTTE HMSEASDSEE  360
VGNGETGVRE KDENEPDTKR RNIEVRVSEP AAAASHRTVT EPRIIVQTTS EVDLLDDGYR  420
WRKYGQKVVK GNPYPRSYYK CTTPGCGVRK HVERAATDAK AVVTTYEGKH NHDLPAAKSS  480
SHAAAAAQLR PDNRHGGLAN LNQQQQQQPV ARLRLKEEQT I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-45236476878Probable WRKY transcription factor 4
2lex_A2e-45236476878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4258350.0AF425835.1 Arabidopsis thaliana WRKY transcription factor 4 (WRKY4) mRNA, complete cds.
GenBankAY0456760.0AY045676.1 Arabidopsis thaliana At1g13960/F7A19_5 mRNA, complete cds.
GenBankBT0026290.0BT002629.1 Arabidopsis thaliana At1g13960/F7A19_5 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303969.10.0hypothetical protein CARUB_v10008859mg
SwissprotQ9XI900.0WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLR0GLP10.0R0GLP1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.1__1511__AT1G13960.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.10.0WRKY DNA-binding protein 4